| Catalog Code: | H00010553-M01 |
| Product Type: | Primary Antibody |
| Product Name: | HTATIP2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 10553 |
| Host: | Mouse |
| Clone: | 4G8 |
| Isotype: | IgG2a lambda |
| Product Description: | Mouse Monoclonal anti-HTATIP2 (4G8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = HTATIP2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-CC3 antibody, anti-TIP30 antibody |
| Immunogen: | HTATIP2 (AAH02439, 1 a.a. ~ 243 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP* ... |
| Specificity: | HTATIP2 - HIV-1 Tat interactive protein 2, 30kDa |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | HTATIP2 |
| Omim ID: | 605628 |