| request information: |
|
| Catalog Code: | H00010544-A01 |
| Product Name: | PROCR Antibody |
| Product Description: | Mouse Polyclonal anti-PROCR |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10544 |
| Gene Symbol: | PROCR |
| Omim ID: | 600646 |
| Immunogen: | PROCR (AAH14451, 1 a.a. ~ 239 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESW
ARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTS
GVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGGFIIAGVAVGIFLCTGGRR
C* |
| Specificity: | PROCR - protein C receptor, endothelial (EPCR) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a receptor for activated protein C, a serine protease activated by and involved in the blood coagulation pathway. The encoded protein is an N-glycosylated type I membrane protein that enhances the activation of protein C. Mutations in this gene have been associated with venous thromboembolism and myocardial infarction, as well as with late fetal loss during pregnancy. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CCCA antibody, anti-CCD41 antibody, anti-EPCR antibody, anti-MGC23024 antibody, anti-bA42O4.2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |