| request information: |
|
| Catalog Code: | H00010539-M01 |
| Product Name: | TXNL2 Antibody |
| Product Description: | Mouse Monoclonal anti-TXNL2 (4B5-2A8) |
| Clone: | 4B5-2A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10539 |
| Gene Symbol: | TXNL2 |
| Immunogen: | TXNL2 (AAH05289, 1 a.a. ~ 336 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAKSENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLG DDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKKGGDTDEDSE ADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLE SKFLREFHDIERKFAEMYQPLLEKRRQIINAIYEPTEEECEY KSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDY AVEEEEEEEEEDDIEATGEENKEEEDPKGIPDFWL |
| Specificity: | TXNL2 - thioredoxin-like 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | May play a role in regulating the function of the thioredoxin system. Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-PICOT antibody, anti-PKC interacting cousin of thioredoxin antibody, anti-PKC theta interacting protein antibody, anti-PKCq interacting protein antibody, anti-Thioredoxin like protein 2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |