| request information: |
|
| Catalog Code: | H00010535-A01 |
| Product Name: | RNASEH2A Antibody |
| Product Description: | Mouse Polyclonal anti-RNASEH2A |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10535 |
| Gene Symbol: | RNASEH2A |
| Omim ID: | 606034 |
| Immunogen: | RNASEH2A (AAH11748, 1 a.a. ~ 300 a.a) full length recombinant protein with GST tag. |
| Epitope: | MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERL
FAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFP
GIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFS
WRTAQTILEKEAEDVIWE |
| Specificity: | RNASEH2A - ribonuclease H2, large subunit |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-JUNB antibody, anti-RNASEHI antibody, anti-RNHIA antibody, anti-RNHL antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |