| request information: |
|
| Catalog Code: | H00010525-M01 |
| Product Name: | HYOU1 Antibody |
| Product Description: | Mouse Monoclonal anti-HYOU1 (6F7) |
| Clone: | 6F7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10525 |
| Gene Symbol: | HYOU1 |
| Omim ID: | 601746, |
| Immunogen: | HYOU1 (NP_006380, 901 a.a. ~ 1000 a.a) partial recombinant protein with GST tag. |
| Epitope: | EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGA
EPEQKEQSTGQKRPLKNDEL* |
| Specificity: | HYOU1 - hypoxia up-regulated 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment is found at the 5' end of the first exon, and is involved in stress-dependent induction. A transcript that is produced from a downstream start site is preferentially induced by hypoxia, resulting in the accumulation of this protein in the endoplasmic reticulum (ER). The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-DKFZp686N08236 antibody, anti-ORP150 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |