| CatalogCode: | H00010525-A02 |
| ProductName: | hypoxia up-regulated 1 Antibody |
| Product Description: | Mouse Polyclonal anti-hypoxia up-regulated 1 |
| Clonality: | Polyclonal |
| Immunogen: | HYOU1 (NP_006380, 901 a.a. ~ 1000 a.a) partial recombinant protein with GST tag. |
| Epitope: | EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL* ... |
| Specificity: | hypoxia up-regulated 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment is found at the 5' end of the first exon, and is involved in stress-dependent induction. A transcript that is produced from a downstream start site is preferentially induced by hypoxia, resulting in the accumulation of this protein in the endoplasmic reticulum (ER). The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp686N08236 antibody, anti-ORP150 antibody |
| ProteinTarget: | hypoxia up-regulated 1 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10525 |
| Gene_Symbol: | HYOU1 |
| Omim_ID: | 601746, |