| request information: |
|
| Catalog Code: | H00010498-A01 |
| Product Name: | coactivator-associated arginine methyltransferase 1 Antibody |
| Product Description: | Mouse Polyclonal anti-coactivator-associated arginine methyltransferase 1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10498 |
| Gene Symbol: | CARM1 |
| Omim ID: | 603934, |
| Immunogen: | CARM1 (NP_954592, 284 a.a. ~ 382 a.a) partial recombinant protein with GST tag. |
| Epitope: | NMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEA
KEGDLHRIEIPFKFHMLHS* |
| Specificity: | coactivator-associated arginine methyltransferase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | Protein arginine N-methyltransferases, such as CARM1, catalyze the transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine. Protein arginine methylation has been implicated in signal transduction, metabolism of nascent pre-RNA, and transcriptional activation (Frankel et al., 2002 [PubMed 11724789]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PRMT4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |