| request information: |
|
| Catalog Code: | H00010497-A01 |
| Product Name: | UNC13B Antibody |
| Product Description: | Mouse Polyclonal anti-UNC13B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10497 |
| Gene Symbol: | UNC13B |
| Omim ID: | 605836 |
| Immunogen: | UNC13B (NP_006368, 1482 a.a. ~ 1592 a.a) partial recombinant protein with GST tag. |
| Epitope: | SKSNNWAPKYNETFHLLLGNEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS* |
| Specificity: | UNC13B - unc-13 homolog B (C. elegans) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is expressed in the kidney cortical epithelial cells and is upregulated by hyperglycemia. The encoded protein shares a high level of similarity to the rat homolog, and contains 3 C2 domains and a diacylglycerol-binding C1 domain. Hyperglycemia increases the levels of diacylglycerol, which has been shown to induce apoptosis in cells transfected with this gene and thus contribute to the renal cell complications of hyperglycemia. Studies in other species also indicate a role for this protein in the priming step of synaptic vesicle exocytosis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MUNC13 antibody, anti-UNC13 antibody, anti-Unc13h2 antibody, anti-hmunc13 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |