ExactAntigen

Mouse Monoclonal anti-CAP1 (4A2) | Novus Biologicals antibody product information
CatalogCode:H00010487-M01
ProductName:CAP1 Antibody
Product Description:Mouse Monoclonal anti-CAP1 (4A2)
Clone:4A2
Clonality:Monoclonal
Immunogen:CAP1 (AAH13963, 1 a.a. ~ 476 a.a) full length recombinant protein with GST tag.
Epitope:MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRS ...
Specificity:CAP1 - CAP, adenylate cyclase-associated protein 1 (yeast)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants have been identified.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CAP antibody, anti-CAP1-PEN antibody
ProteinTarget:CAP1 - CAP, adenylate cyclase-associated protein 1 (yeast)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:10487
Gene_Symbol:CAP1
order or
more information
:
company product webpage
request information:
Also see:
all human CAP1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about