| request information: |
|
| Catalog Code: | H00010487-A01 |
| Product Name: | CAP1 Antibody |
| Product Description: | Mouse Polyclonal anti-CAP1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10487 |
| Gene Symbol: | CAP1 |
| Immunogen: | CAP1 (AAH13963, 1 a.a. ~ 476 a.a) full length recombinant protein with GST tag. |
| Epitope: | MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTG
LKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMN
DAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGP
PPPPVSTSSGSDESASRS |
| Specificity: | CAP1 - CAP, adenylate cyclase-associated protein 1 (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAP antibody, anti-CAP1-PEN antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | 1. Cauwe B, Martens E, Van den Steen PE, et al. Adenylyl cyclase-associated protein-1/CAP1 as a biological target substrate of gelatinase B/MMP-9. Experimental Cell Research doi: 10.1016 /j.yexcr. 2008.07.008 |
order or
more information: | company product webpage |