| request information: |
|
| Catalog Code: | H00010486-M01 |
| Product Name: | CAP2 Antibody |
| Product Description: | Mouse Monoclonal anti-CAP2 (3G9-1A5) |
| Clone: | 3G9-1A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10486 |
| Gene Symbol: | CAP2 |
| Immunogen: | CAP2 (AAH08481, 1 a.a. ~ 478 a.a) full length recombinant protein with GST tag. |
| Epitope: | MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGDVETHAEMVH
SAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKE
MNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPP
LPPPGPPPLFENEGKKEE |
| Specificity: | CAP2 - CAP, adenylate cyclase-associated protein, 2 (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein and actin. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |