| request information: | |
| Catalog Code: | H00010460-M02 |
| Product Name: | TACC3 Antibody |
| Product Description: | Mouse Monoclonal anti-TACC3 (6C4) |
| Clone: | 6C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10460 |
| Gene Symbol: | TACC3 |
| Omim ID: | 605303, |
| Immunogen: | TACC3 (NP_006333, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLE APFTQDDTLGLENSHPVWTQK* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ERIC1 antibody, anti-MGC117382 antibody, anti-MGC133242 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |