| request information: |
|
| Catalog Code: | H00010460-A01 |
| Product Name: | TACC3 Antibody |
| Product Description: | Mouse Polyclonal anti-TACC3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10460 |
| Gene Symbol: | TACC3 |
| Omim ID: | 605303, |
| Immunogen: | TACC3 (NP_006333, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLE
APFTQDDTLGLENSHPVWTQK* |
| Specificity: | TACC3 - transforming, acidic coiled-coil containing protein 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ERIC1 antibody, anti-MGC117382 antibody, anti-MGC133242 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |