ExactAntigen

Mouse Monoclonal anti-MAP3K7IP1 (2A12) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00010454-M03
ProductName: MAP3K7IP1 Antibody
Product Description: Mouse Monoclonal anti-MAP3K7IP1 (2A12)
Clone: 2A12
Clonality: Monoclonal
Immunogen: MAP3K7IP1 (NP_705717, 3 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope: AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-MGC57664 antibody, anti-TAB1 antibody
ProteinTarget: mitogen-activated protein kinase kinase kinase 7 interacting protein 1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 10454
Gene_Symbol: MAP3K7IP1
Omim_ID: 602615,
more information: company product webpage
Also see:
see all human TAB1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about