| Catalog Code: | H00010439-M01 |
| Product Type: | Primary Antibody |
| Product Name: | OLFM1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 10439 |
| Host: | Mouse |
| Clone: | 2G12-1B3 |
| Isotype: | IgG1 kappa |
| Product Description: | Mouse Monoclonal anti-OLFM1 (2G12-1B3) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = OLFM1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene product s |
| Alternate Names: | anti-AMY antibody, anti-NOE1 antibody, anti-NOELIN antibody, anti-NOELIN1 antibody, anti-NOELIN1_V1 antibody, anti-NOELIN1_V2 antibody, anti-NOELIN1_V4 antibody, anti-OlfA antibody |
| Immunogen: | OLFM1 (AAH00189, 1 a.a. ~ 170 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD* ... |
| Specificity: | OLFM1 - olfactomedin 1 |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Product References: | Laterza OF, Ladenson JH et al.. Identification of Novel Brain Biomarkers Clin Chem. 2006 Sep;52(9):1713-21. Epub 2006 Jul 20. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | OLFM1 |
| Omim ID: | 605366 |