ExactAntigen

OLFM1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010439-M01
Product Type:Primary Antibody
Product Name:OLFM1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10439
Host:Mouse
Clone:2G12-1B3
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-OLFM1 (2G12-1B3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = OLFM1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene product s
Alternate Names:anti-AMY antibody, anti-NOE1 antibody, anti-NOELIN antibody, anti-NOELIN1 antibody, anti-NOELIN1_V1 antibody, anti-NOELIN1_V2 antibody, anti-NOELIN1_V4 antibody, anti-OlfA antibody
Immunogen:OLFM1 (AAH00189, 1 a.a. ~ 170 a.a) full length recombinant protein with GST tag.
Epitope:MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD* ...
Specificity:OLFM1 - olfactomedin 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Product References:Laterza OF, Ladenson JH et al.. Identification of Novel Brain Biomarkers Clin Chem. 2006 Sep;52(9):1713-21. Epub 2006 Jul 20.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:OLFM1
Omim ID:605366
see all human OLFM1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about