ExactAntigen

CFDP1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00010428-M04
Product Name:CFDP1 Antibody
Product Description:Mouse Monoclonal anti-CFDP1 (5B7)
Clone:5B7
Clonality:Monoclonal
ListPrice:295
Gene ID:10428
Gene Symbol:CFDP1
Omim ID:608108,
Immunogen:CFDP1 (NP_006315, 168 a.a. ~ 252 a.a) partial recombinant protein with GST tag.
Epitope:VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKL
DWESF*
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-BCNT antibody, anti-CP27 antibody, anti-SWC5 antibody, anti-p97 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human CFDP1 antibodies


2008©ExactAntigen home | browse | about