| request information: |
|
| Catalog Code: | H00010418-M01 |
| Product Name: | SPON1 Antibody |
| Product Description: | Mouse Monoclonal anti-SPON1 (3F4) |
| Clone: | 3F4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10418 |
| Gene Symbol: | SPON1 |
| Omim ID: | 604989, |
| Immunogen: | SPON1 (NP_006099, 699 a.a. ~ 807 a.a) partial recombinant protein with GST tag. |
| Epitope: | PQFGGAPCPETVQRKKCRIRKCLRNPSIQKLRWREARESRRS EQLKEESEGEQFPGCRMRPWTAWSECTKLCGGGIQERYMTVK KRFKSSQFTSCKDKKEIRACNVHP* |
| Specificity: | SPON1 - spondin 1, extracellular matrix protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Localization: | Secreted protein; extracellular space; extracellular matrix. |
| Background: | SPON1 is a member of a subgroup of the thrombospondin type 1 (TSR) class molecules, defined by two domains of homology, the FS1/FS2 and TSR domains. The TSRs of SPON1 proteins are typical of class 2 TSRs. SPON1, which is similar to thrombospondin, is a extracellular matrix attached molecule that promotes neurite outgrowth and inhibits angiogenesis. Analysis of gain and loss of function experiments reveal that SPON1 is required for accurate pathfinding of embryonic axons, and plays a dual role in patterning axonal trajectories. It promotes the outgrowth of commissural and inhibits the outgrowth of motor axons, and has also been implicated in inflammatory processes in the nervous system. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-F spondin antibody, anti-F spondin extracellular matrix protein antibody, anti-FSPO antibody, anti-KIAA0762 antibody, anti-MGC10724 antibody, anti-SPON 1 antibody, anti-spondin 1 (f spondin) extracellular matrix protein antibody, anti-Spondin 1 antibody, anti-Spondin 1 extracellular matrix protein antibody, anti-Spondin 1 precursor antibody, anti-Spondin1 antibody, anti-Vascular smooth muscle cell growth promoting factor antibody, anti-VSGP antibody, anti-VSGP/F spondin antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |