ExactAntigen

Mouse Monoclonal anti-Yes-associated protein 1, 65kDa (2H1)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00010413-M03
ProductName:Yes-associated protein 1, 65kDa Antibody
Product Description:Mouse Monoclonal anti-Yes-associated protein 1, 65kDa (2H1)
Clone:2H1
Clonality:Monoclonal
Immunogen:YAP1 (NP_006097, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag.
Epitope:QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR* ...
Specificity:Yes-associated protein 1, 65kDa
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:1X PBS pH 7.2
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-YAP antibody, anti-YAP2 antibody, anti-YAP65 antibody
ProteinTarget:Yes-associated protein 1, 65kDa
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:10413
Gene_Symbol:YAP1
Omim_ID:606608,
see all human YAP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about