| request information: |
|
| Catalog Code: | H00010413-M01 |
| Product Name: | YAP1 Antibody |
| Product Description: | Mouse Monoclonal anti-YAP1 (2F12) |
| Clone: | 2F12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10413 |
| Gene Symbol: | YAP1 |
| Omim ID: | 606608, |
| Immunogen: | YAP1 (NP_006097, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. |
| Epitope: | QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDS FFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGA VSPGTLTPTGVVSGPAATPTAQHLR* |
| Specificity: | YAP1 - Yes-associated protein 1, 65kDa |
| Cross Reactivity: | Human, mouse and rat. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Cytoplasmic and Nuclear |
| Background: | This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate Buffered Saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , Mu , Rt |
| Alternate Names: | anti-65 kDa Yes associated protein antibody, anti-YAp 1 antibody, anti-YAP 65 antibody, anti-YAP antibody, anti-YAP2 antibody, anti-YAP65 antibody, anti-Yes associated protein 1 65kDa antibody, anti-Yes associated protein 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |