| CatalogCode: | H00010410-B01 |
| ProductName: | IFITM3 Antibody |
| Product Description: | Mouse Polyclonal anti-IFITM3 |
| Clonality: | Polyclonal |
| Immunogen: | IFITM3 (AAH06794, 1 a.a. ~ 134 a.a) full-length human protein. |
| Epitope: | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG* ... |
| Specificity: | Mouse polyclonal antibody raised against a full-length human IFITM3 protein. |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on transfected lysate.Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-1-8U antibody |
| ProteinTarget: | IFITM3 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 10410 |
| Gene_Symbol: | IFITM3 |
| Omim_ID: | 605579, |