ExactAntigen

NDRG1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010397-M03
Product Type:Primary Antibody
Product Name:NDRG1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10397
Host:Mouse
Clone:2D7
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-NDRG1 (2D7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = NDRG1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene is a memb
Alternate Names:anti-cap43 antibody, anti-cmt4d antibody, anti-Differentiation related gene1 protein antibody, anti-drg1 antibody, anti-gc4 antibody, anti-hmsnl antibody, anti-Human mRNA for RTP complete cds antibody, anti-ndr1 antibody, anti-NDRG1 protein antibody, anti
Immunogen:NDRG1 (AAH03175, 1 a.a. ~ 395 a.a) full length recombinant protein with GST tag.
Epitope:MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPA ...
Specificity:NDRG1 - N-myc downstream regulated gene 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NDRG1
Omim ID:601455, 605262,
see all human NDRG1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about