| CatalogCode: | H00010397-M01 |
| ProductName: | NDRG1 Antibody |
| Product Description: | Mouse Monoclonal anti-NDRG1 (4G1-1D8-1C1) |
| Clone: | 4G1-1D8-1C1 |
| Clonality: | Monoclonal |
| Immunogen: | NDRG1 (AAH03175, 1 a.a. ~ 395 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPA ... |
| Specificity: | NDRG1 - N-myc downstream regulated gene 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-cap43 antibody, anti-cmt4d antibody, anti-Differentiation related gene1 protein antibody, anti-drg1 antibody, anti-gc4 antibody, anti-hmsnl antibody, anti-Human mRNA for RTP complete cds antibody, anti-ndr1 antibody, anti-NDRG1 protein antibody, anti-Nickel specific induction protein Cap43 antibody, anti-nmsl antibody, anti-Nmyc downstream regulated antibody, anti-Nmyc downstream regulated gene1 antibody, anti-Nmyc downstream regulated gene1 protein antibody, anti-Protein regulated by oxygen1 antibody, anti-proxy1 antibody, anti-Reducing agents and tunicamycin responsive protein antibody, anti-rit42 antibody, anti-rtp antibody, anti-targ1 antibody, anti-tdds antibody |
| ProteinTarget: | NDRG1 - N-myc downstream regulated gene 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10397 |
| Gene_Symbol: | NDRG1 |
| Omim_ID: | 601,455,605,262 H00010397-M03 |
order or
more information: | company product webpage |
| request information: |
|