| request information: |
|
| Catalog Code: | H00010397-A01 |
| Product Name: | NDRG1 Antibody |
| Product Description: | Mouse Polyclonal anti-NDRG1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10397 |
| Gene Symbol: | NDRG1 |
| Omim ID: | 601455 605262 |
| Immunogen: | NDRG1 (AAH03175, 1 a.a. ~ 395 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNY
EDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVE
GLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDL
EIERPMPGTHTVTLQCPA |
| Specificity: | NDRG1 - N-myc downstream regulated gene 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-cap43 antibody, anti-cmt4d antibody, anti-Differentiation related gene1 protein antibody, anti-drg1 antibody, anti-gc4 antibody, anti-hmsnl antibody, anti-Human mRNA for RTP complete cds antibody, anti-ndr1 antibody, anti-NDRG1 protein antibody, anti-Nickel specific induction protein Cap43 antibody, anti-nmsl antibody, anti-Nmyc downstream regulated antibody, anti-Nmyc downstream regulated gene1 antibody, anti-Nmyc downstream regulated gene1 protein antibody, anti-Protein regulated by oxygen1 antibody, anti-proxy1 antibody, anti-Reducing agents and tunicamycin responsive protein antibody, anti-rit42 antibody, anti-rtp antibody, anti-targ1 antibody, anti-tdds antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |