| CatalogCode: | | H00010392-A01 |
| ProductName: | | CARD4 Antibody |
| Product Description: | | Mouse Polyclonal anti-CARD4 |
| Clonality: | | Polyclonal |
| Immunogen: | | CARD4 (AAH40339, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. |
| Epitope: | | MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQL* ... |
| Specificity: | | Mouse polyclonal antibody raised against a partial recombinant CARD4. |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein.Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-NOD1 antibody |
| ProteinTarget: | | CARD4 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 10392 |
| Gene_Symbol: | | CARD4 |
| Omim_ID: | | 605980, |
| more information: | | company product webpage |