| request information: |
|
| Catalog Code: | H00010365-A01 |
| Product Name: | KLF2 Antibody |
| Product Description: | Mouse Polyclonal anti-KLF2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10365 |
| Gene Symbol: | KLF2 |
| Omim ID: | 602016 |
| Immunogen: | KLF2 (NP_057354, 1 a.a. ~ 57 a.a) partial recombinant protein with GST tag. |
| Epitope: | MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL* |
| Specificity: | KLF2 - Kruppel-like factor 2 (lung) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Kruppel-like factor 2 (lung) antibody, anti-Kruppel-like factor antibody, anti-Lklf antibody, anti-Lung Kruppel-like zinc finger transcription factor antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |