| request information: |
|
| Catalog Code: | H00010362-M01 |
| Product Name: | HMG20B Antibody |
| Product Description: | Mouse Monoclonal anti-HMG20B (1F6) |
| Clone: | 1F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10362 |
| Gene Symbol: | HMG20B |
| Omim ID: | 605535 |
| Immunogen: | HMG20B (NP_006330, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFS
TFDVPIFTEEFLDQNKAREAELRRLRKMNV* |
| Specificity: | HMG20B - high-mobility group 20B |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BRAF25 antibody, anti-BRAF35 antibody, anti-HMGX2 antibody, anti-SMARCE1r antibody, anti-SOXL antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |