ExactAntigen

Mouse Monoclonal anti-ABCA10 (8F4)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00010349-M01
ProductName:ABCA10 Antibody
Product Description:Mouse Monoclonal anti-ABCA10 (8F4)
Clone:8F4
Clonality:Monoclonal
Immunogen:ABCA10 (NP_525021, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag.
Epitope:MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL* ...
Specificity:ABCA10 - ATP-binding cassette, sub-family A (ABC1), member 10
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-EST698739 antibody
ProteinTarget:ABCA10 - ATP-binding cassette, sub-family A (ABC1), member 10
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:10349
Gene_Symbol:ABCA10
see all human ABCA10 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about