| request information: |
|
| Catalog Code: | H00010349-A01 |
| Product Name: | ATP-binding cassette, sub-family A (ABC1), member 10 Antibody |
| Product Description: | Mouse Polyclonal anti-ATP-binding cassette, sub-family A (ABC1), member 10 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10349 |
| Gene Symbol: | ABCA10 |
| Immunogen: | ABCA10 (NP_525021, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. |
| Epitope: | MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCY
L* |
| Specificity: | ATP-binding cassette, sub-family A (ABC1), member 10 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EST698739 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |