| request information: |
|
| Catalog Code: | H00010331-A01 |
| Product Name: | B3GNT3 Antibody |
| Product Description: | Mouse Polyclonal anti-B3GNT3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10331 |
| Gene Symbol: | B3GNT3 |
| Omim ID: | 605863, |
| Immunogen: | B3GNT3 (NP_055071, 135 a.a. ~ 209 a.a) partial recombinant protein with GST tag. |
| Epitope: | KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN* |
| Specificity: | B3GNT3 - UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-B3GAL-T8 antibody, anti-B3GN-T3 antibody, anti-B3GNT-3 antibody, anti-HP10328 antibody, anti-TMEM3 antibody, anti-beta3Gn-T3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |