| request information: |
|
| Catalog Code: | H00010327-M01 |
| Product Name: | AKR1A1 Antibody |
| Product Description: | Mouse Monoclonal anti-AKR1A1 (1A11-2A4) |
| Clone: | 1A11-2A4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10327 |
| Gene Symbol: | AKR1A1 |
| Omim ID: | 103830, |
| Immunogen: | AKR1A1 (AAH00670, 1 a.a. ~ 326 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTS
KLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQA
LGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLAL
AEKYGRSPAQILLRWQVQ |
| Specificity: | AKR1A1 - aldo-keto reductase family 1, member A1 (aldehyde reductase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Alternative splicing of this gene results in two transcript variants encoding the same protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-Aldehyde reductase antibody, anti-aldo-keto reductase family 1 member A1 (aldehyde reductase) antibody, anti-ALDR1 antibody, anti-ALR antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | 1. Bains OS, et al. Two allelic variants of aldo-keto reductase 1A1 exhibit reduced in vitro metabolism of daunorubicin. Drug Metab Dispos. Feb 14 2008. |
order or
more information: | company product webpage |