| request information: |
|
| Catalog Code: | H00010325-M01 |
| Product Name: | RRAGB Antibody |
| Product Description: | Mouse Monoclonal anti-RRAGB (2B8) |
| Clone: | 2B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10325 |
| Gene Symbol: | RRAGB |
| Immunogen: | RRAGB (AAH34726, 1 a.a. ~ 347 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKK VLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVR FLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFD VESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQED QRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIV YQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFL |
| Specificity: | RRAGB - Ras-related GTP binding B |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasm |
| Background: | Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-bA465E19.1 antibody, anti-Rag B antibody, anti-RagB antibody, anti-Ras-related GTP-binding protein B antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |