| CatalogCode: | H00010290-M01 |
| ProductName: | APEG1 Antibody |
| Product Description: | Mouse Monoclonal anti-APEG1 (2C2-2C7) |
| Clone: | 2C2-2C7 |
| Clonality: | Monoclonal |
| Immunogen: | APEG1 (AAH06346, 1 a.a. ~ 114 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE* ... |
| Specificity: | APEG1 - aortic preferentially expressed gene 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-KIAA1297 antibody, anti-MGC12676 antibody, anti-SPEG antibody |
| ProteinTarget: | APEG1 - aortic preferentially expressed gene 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10290 |
| Gene_Symbol: | APEG1 |
order or
more information: | company product webpage |
| request information: |
|