| request information: |
|
| Catalog Code: | H00010285-M01 |
| Product Name: | SMNDC1 Antibody |
| Product Description: | Mouse Monoclonal anti-SMNDC1 (2B9) |
| Clone: | 2B9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10285 |
| Gene Symbol: | SMNDC1 |
| Omim ID: | 603519 |
| Immunogen: | SMNDC1 (AAH11234, 1 a.a. ~ 239 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEV IELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWS EDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVE EGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELE QEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVG VGTCGIADKPMTQYQDTSKYNVRHLMPQ* |
| Specificity: | SMNDC1 - survival motor neuron domain containing 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Localization: | Nucleus speckle. Nucleus, Cajal body. Note=Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies. |
| Background: | Necessary for spliceosome assembly. Overexpression causes apoptosis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-30 kDa splicing factor SMNrp antibody, anti-SMN related protein antibody, anti-SMNR antibody, anti-SPF30 antibody, anti-Survival motor neuron domain containing protein 1 antibody, anti-Survival of motor neuron related splicing factor 30 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |