ExactAntigen

SAP18 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010284-M01
Product Type:Primary Antibody
Product Name:SAP18 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10284
Host:Mouse
Clone:3B2
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-SAP18 (3B2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.Histone acetylation plays a key role in the regulation of euk
Alternate Names:anti-2HOR0202 antibody, anti-MGC27131 antibody, anti-SAP18p antibody
Immunogen:SAP18 (AAH30836, 1 a.a. ~ 154 a.a) full length recombinant protein with GST tag.
Epitope:MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPY* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SAP18
Omim ID:602949,
see all human SAP18 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about