| request information: |
|
| Catalog Code: | H00010277-A01 |
| Product Name: | UBE4B Antibody |
| Product Description: | Mouse Polyclonal anti-UBE4B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10277 |
| Gene Symbol: | UBE4B |
| Immunogen: | UBE4B (NP_006039, 1075 a.a. ~ 1174 a.a) partial recombinant protein with GST tag. |
| Epitope: | FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEP
VPELKEQIQAWMREKQNSDH* |
| Specificity: | UBE4B - ubiquitination factor E4B (UFD2 homolog, yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-686 antibody, anti-E4 antibody, anti-HDNB1 antibody, anti-KIAA0684 antibody, anti-UBOX3 antibody, anti-UFD2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |