| request information: |
|
| Catalog Code: | H00010254-A01 |
| Product Name: | STAM2 Antibody |
| Product Description: | Mouse Polyclonal anti-STAM2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 10254 |
| Gene Symbol: | STAM2 |
| Omim ID: | 606244 |
| Immunogen: | STAM2 (NP_005834, 416 a.a. ~ 526 a.a) partial recombinant protein with GST tag. |
| Epitope: | QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTT
SNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL* |
| Specificity: | STAM2 - signal transducing adaptor molecule (SH3 domain and ITAM motif) 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is closely related to STAM, an adaptor protein involved in the downstream signaling of cytokine receptors, both of which contain a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). Similar to STAM, this protein acts downstream of JAK kinases, and is phosphorylated in response to cytokine stimulation. This protein and STAM thus are thought to exhibit compensatory effects on the signaling pathway downstream of JAK kinases upon cytokine stimulation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-STAM2 antibody, anti-signal transducing adaptor molecule (SH3 domain and ITAM motif) 2antibody, anti-HGNC:11358 antibody, anti-DKFZp564C047 antibody, anti-Hbp antibody, anti-STAM2A antibody, anti-STAM2Bantibody, anti-STAM-like protein containing SH3 and ITAM domains 2 antibody, anti-signal transducing adaptor molecule 2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |