ExactAntigen

CALCOCO2 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00010241-M05
Product Name:CALCOCO2 Antibody
Product Description:Mouse Monoclonal anti-CALCOCO2 (3H6)
Clone:3H6
Clonality:Monoclonal
ListPrice:295
Gene ID:10241
Gene Symbol:CALCOCO2
Omim ID:604587,
Immunogen:CALCOCO2 (NP_005822, 347 a.a. ~ 447 a.a) partial recombinant protein with GST tag.
Epitope:SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSS PSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFP ATEKQIFEDHVFCHSL*
Specificity:CALCOCO2 - calcium binding and coiled-coil domain 2
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:Ascites
Isotype:IgG Mix Kappa
Host Name:Mouse
Buffer:Phosphate buffered saline, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-MGC17318 antibody, anti-NDP52 antibody, anti-Calcium binding and coiled coil domain 2 antibody, anti-Nuclear domain protein 52 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human CALCOCO2 antibodies


2008©ExactAntigen home | browse | about