| request information: | |
| Catalog Code: | H00010241-M05 |
| Product Name: | CALCOCO2 Antibody |
| Product Description: | Mouse Monoclonal anti-CALCOCO2 (3H6) |
| Clone: | 3H6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10241 |
| Gene Symbol: | CALCOCO2 |
| Omim ID: | 604587, |
| Immunogen: | CALCOCO2 (NP_005822, 347 a.a. ~ 447 a.a) partial recombinant protein with GST tag. |
| Epitope: | SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSS PSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFP ATEKQIFEDHVFCHSL* |
| Specificity: | CALCOCO2 - calcium binding and coiled-coil domain 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Ascites |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC17318 antibody, anti-NDP52 antibody, anti-Calcium binding and coiled coil domain 2 antibody, anti-Nuclear domain protein 52 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |