| request information: |
|
| Catalog Code: | H00010228-M01 |
| Product Name: | STX6 Antibody |
| Product Description: | Mouse Monoclonal anti-STX6 (1G2) |
| Clone: | 1G2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10228 |
| Gene Symbol: | STX6 |
| Omim ID: | 603944 |
| Immunogen: | STX6 (AAH09944, 1 a.a. ~ 256 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFN
LDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQ
QAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCA
IAILFAVLLVVLILFLVL |
| Specificity: | STX6 - syntaxin 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-STX6 antibody, anti-syntaxin 6antibody, anti-HGNC:11441 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |