ExactAntigen

Mouse Monoclonal anti-CD96 (3H8) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00010225-M01
ProductName: CD96 Antibody
Product Description: Mouse Monoclonal anti-CD96 (3H8)
Clone: 3H8
Clonality: Monoclonal
Immunogen: CD96 (AAH20749, 1 a.a. ~ 403 a.a) full length recombinant protein with GST tag.
Epitope: MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAVYHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWSVEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEI ...
Specificity: CD96 - CD96 antigen
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-DKFZp667E2122 antibody, anti-MGC22596 antibody, anti-TACTILE antibody
ProteinTarget: CD96 - CD96 antigen
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 10225
Gene_Symbol: CD96
Omim_ID: 606037,
more information: company product webpage
Also see:
see all human CD96 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about