| CatalogCode: | H00010216-M01 |
| ProductName: | PRG4 Antibody |
| Product Description: | Mouse Monoclonal anti-PRG4 (2A6) |
| Clone: | 2A6 |
| Clonality: | Monoclonal |
| Immunogen: | PRG4 (NP_005798, 1305 a.a. ~ 1405 a.a) partial recombinant protein with GST tag. |
| Epitope: | ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP* ... |
| Specificity: | PRG4 - proteoglycan 4 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CACP antibody, anti-HAPO antibody, anti-JCAP antibody, anti-MSF antibody, anti-SZP antibody, anti-bG174L6.2 antibody |
| ProteinTarget: | PRG4 - proteoglycan 4 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10216 |
| Gene_Symbol: | PRG4 |
| Omim_ID: | 208250, 604283, |
order or
more information: | company product webpage |
| request information: |
|