| Catalog Code: | H00010215-M06 |
| Product Type: | Primary Antibody |
| Product Name: | OLIG2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 10215 |
| Host: | Mouse |
| Clone: | 2B11 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-OLIG2 (2B11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal transl |
| Alternate Names: | anti-BHLHB1 antibody, anti-OLIGO2 antibody, anti-PRKCBP2 antibody, anti-RACK17 antibody |
| Immunogen: | OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. |
| Epitope: | DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | OLIG2 |
| Omim ID: | 606386, |