ExactAntigen

Mouse Monoclonal anti-OLIG2 (3C9)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00010215-M03
ProductName:OLIG2 Antibody
Product Description:Mouse Monoclonal anti-OLIG2 (3C9)
Clone:3C9
Clonality:Monoclonal
Immunogen:OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag.
Epitope:DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-BHLHB1 antibody, anti-OLIGO2 antibody, anti-PRKCBP2 antibody, anti-RACK17 antibody
ProteinTarget:OLIG2
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:10215
Gene_Symbol:OLIG2
Omim_ID:606386,
see all human OLIG2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about