ExactAntigen

OLIG2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00010215-M02
Product Type:Primary Antibody
Product Name:OLIG2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:10215
Host:Mouse
Clone:3D7
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-OLIG2 (3D7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal transl
Alternate Names:anti-BHLHB1 antibody, anti-OLIGO2 antibody, anti-PRKCBP2 antibody, anti-RACK17 antibody
Immunogen:OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag.
Epitope:DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSS ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:OLIG2
Omim ID:606386,
see all human OLIG2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about