| request information: |
|
| Catalog Code: | H00010213-M01 |
| Product Name: | PSMD14 Antibody |
| Product Description: | Mouse Monoclonal anti-PSMD14 (4A10-E8) |
| Clone: | 4A10-E8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10213 |
| Gene Symbol: | PSMD14 |
| Omim ID: | 607173, |
| Immunogen: | PSMD14 (AAH09524, 1 a.a. ~ 96 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNK AVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQC LAAMLDTVVFK* |
| Specificity: | PSMD14 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Localization: | Cytoplasmic and Nuclear |
| Background: | PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PAD1 antibody, anti-POH1 antibody, anti-rpn11 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |