ExactAntigen

Mouse Polyclonal anti-PSMD14 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 14, MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00010213-B02
ProductName:PSMD14 Antibody
Product Description:Mouse Polyclonal anti-PSMD14 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 14, MaxPab Antibody
Clonality:Polyclonal
Immunogen:PSMD14 (-, 1 a.a. ~ 310 a.a) full-length human protein.
Epitope:MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNY ...
CrossReactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background:PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-PAD1 antibody, anti-POH1 antibody, anti-rpn11 antibody
ProteinTarget:proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:10213
Gene_Symbol:PSMD14
see all human PSMD14 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about