| CatalogCode: | H00010201-B01 |
| ProductName: | NME6 Antibody |
| Product Description: | Mouse Polyclonal anti-NME6 - non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) |
| Clone: | non-metastatic cells 6, protein expresse |
| Clonality: | Polyclonal |
| Immunogen: | NME6 (AAH01808, 1 a.a. ~ 195 a.a) full-length human protein.MW of the GST tag alone is 26 KDa. |
| Epitope: | MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the NM23 gene family (see MIM 156490).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-IPIA-ALPHA antibody, anti-NM23-H6 antibody |
| ProteinTarget: | non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 10201 |
| Gene_Symbol: | NME6 |
order or more information: | company product webpage |
| request information: | |