ExactAntigen

Mouse Polyclonal anti-FARP1 - FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived), MaxPab Antibody | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00010160-B01
ProductName: FARP1 Antibody
Product Description: Mouse Polyclonal anti-FARP1 - FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived), MaxPab Antibody
Clonality: Polyclonal
Immunogen: FARP1 (-, 1 a.a. ~ 129 a.a) full-length human protein.
Epitope: MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF ...
CrossReactivity: Human.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background: This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-CDEP antibody, anti-MGC87400 antibody, anti-PLEKHC2 antibody
ProteinTarget: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 10160
Gene_Symbol: FARP1
more information: company product webpage
Also see:
see all human CDEP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about