| CatalogCode: | H00010155-M02 |
| ProductName: | TRIM28 Antibody |
| Product Description: | Mouse Monoclonal anti-TRIM28 (1D11) |
| Clone: | 1D11 |
| Clonality: | Monoclonal |
| Immunogen: | TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. |
| Epitope: | IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-KAP1 antibody, anti-RNF96 antibody, anti-TF1B antibody, anti-TIF1B antibody |
| ProteinTarget: | tripartite motif-containing 28 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 10155 |
| Gene_Symbol: | TRIM28 |
| Omim_ID: | 601742, |
order or
more information: | company product webpage |
| request information: |
|