| CatalogCode: | | H00010148-M01 |
| ProductName: | | Epstein-Barr virus induced gene 3 Antibody |
| Product Description: | | Mouse Monoclonal anti-Epstein-Barr virus induced gene 3 (1D3) |
| Clone: | | 1D3 |
| Clonality: | | Monoclonal |
| Immunogen: | | EBI3 (NP_005746, 129 a.a. ~ 230 a.a) partial recombinant protein with GST tag. |
| Epitope: | | PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK* ... |
| Specificity: | | Epstein-Barr virus induced gene 3 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody reactive against recombinant protein on ELISA. |
| Background: | | This gene was identified by the induction of its expression in B lymphocytes by Epstein-Barr virus infection. The protein encoded by this gene is a secreted glycoprotein, which is a member of the hematopoietin receptor family related to the p40 subunit of interleukin 12 (IL-12). It might play a role in regulating cell-mediated immune responses. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| Buffer: | | 1X PBS pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA |
| SpeciesSummary: | | Hu |
| ProteinTarget: | | Epstein-Barr virus induced gene 3 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 10148 |
| Gene_Symbol: | | EBI3 |
| Omim_ID: | | 605816, |
| more information: | | company product webpage |