ExactAntigen

Mouse Monoclonal anti-Epstein-Barr virus induced gene 3 (1D3) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00010148-M01
ProductName: Epstein-Barr virus induced gene 3 Antibody
Product Description: Mouse Monoclonal anti-Epstein-Barr virus induced gene 3 (1D3)
Clone: 1D3
Clonality: Monoclonal
Immunogen: EBI3 (NP_005746, 129 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Epitope: PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK* ...
Specificity: Epstein-Barr virus induced gene 3
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Background: This gene was identified by the induction of its expression in B lymphocytes by Epstein-Barr virus infection. The protein encoded by this gene is a secreted glycoprotein, which is a member of the hematopoietin receptor family related to the p40 subunit of interleukin 12 (IL-12). It might play a role in regulating cell-mediated immune responses.
Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: 1X PBS pH 7.2
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ProteinTarget: Epstein-Barr virus induced gene 3
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 10148
Gene_Symbol: EBI3
Omim_ID: 605816,
more information: company product webpage
Also see:
see all human EBI3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about