| request information: | |
| Catalog Code: | H00010147-M01 |
| Product Name: | SFRS14 Antibody |
| Product Description: | Mouse Monoclonal anti-SFRS14 (3C5) |
| Clone: | 3C5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 10147 |
| Gene Symbol: | SFRS14 |
| Omim ID: | 607993, |
| Immunogen: | SFRS14 (NP_055699, 579 a.a. ~ 675 a.a) partial recombinant protein with GST tag. |
| Epitope: | PQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCA VRAMLYSRAVRNLKKKL* |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | protein A purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |
|